Anti BTG2 pAb (ATL-HPA002355)

Atlas Antibodies

SKU: ATL-HPA002355-25

• 
• 

Protein Description: BTG family, member 2
Gene Name: BTG2
Alternative Gene Name: MGC126063, MGC126064, PC3, TIS21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020423: 92%, ENSRNOG00000003300: 92%
Entrez Gene ID: 7832
Uniprot ID: P78543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLG
• Gene Sequence: QEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLG
• Gene ID - Mouse: ENSMUSG00000020423
• Gene ID - Rat: ENSRNOG00000003300
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.