Anti BTG2 pAb (ATL-HPA002355)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002355-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BTG2
Alternative Gene Name: MGC126063, MGC126064, PC3, TIS21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020423: 92%, ENSRNOG00000003300: 92%
Entrez Gene ID: 7832
Uniprot ID: P78543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLG |
Gene Sequence | QEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLG |
Gene ID - Mouse | ENSMUSG00000020423 |
Gene ID - Rat | ENSRNOG00000003300 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BTG2 pAb (ATL-HPA002355) | |
Datasheet | Anti BTG2 pAb (ATL-HPA002355) Datasheet (External Link) |
Vendor Page | Anti BTG2 pAb (ATL-HPA002355) at Atlas Antibodies |
Documents & Links for Anti BTG2 pAb (ATL-HPA002355) | |
Datasheet | Anti BTG2 pAb (ATL-HPA002355) Datasheet (External Link) |
Vendor Page | Anti BTG2 pAb (ATL-HPA002355) |