Anti BTG2 pAb (ATL-HPA002355)

Atlas Antibodies

Catalog No.:
ATL-HPA002355-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: BTG family, member 2
Gene Name: BTG2
Alternative Gene Name: MGC126063, MGC126064, PC3, TIS21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020423: 92%, ENSRNOG00000003300: 92%
Entrez Gene ID: 7832
Uniprot ID: P78543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLG
Gene Sequence QEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLG
Gene ID - Mouse ENSMUSG00000020423
Gene ID - Rat ENSRNOG00000003300
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BTG2 pAb (ATL-HPA002355)
Datasheet Anti BTG2 pAb (ATL-HPA002355) Datasheet (External Link)
Vendor Page Anti BTG2 pAb (ATL-HPA002355) at Atlas Antibodies

Documents & Links for Anti BTG2 pAb (ATL-HPA002355)
Datasheet Anti BTG2 pAb (ATL-HPA002355) Datasheet (External Link)
Vendor Page Anti BTG2 pAb (ATL-HPA002355)