Anti BTF3L4 pAb (ATL-HPA067026)

Atlas Antibodies

Catalog No.: ATL-HPA067026-25

Protein Description: basic transcription factor 3-like 4
Gene Name: BTF3L4
Alternative Gene Name: MGC23908
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028568: 100%, ENSRNOG00000008512: 100%
Entrez Gene ID: 91408
Uniprot ID: Q96K17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDV
• Gene Sequence: TSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDV
• Gene ID - Mouse: ENSMUSG00000028568
• Gene ID - Rat: ENSRNOG00000008512
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.