Anti BTD pAb (ATL-HPA052275)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052275-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BTD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021900: 90%, ENSRNOG00000019656: 86%
Entrez Gene ID: 686
Uniprot ID: P43251
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVA |
Gene Sequence | NLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVA |
Gene ID - Mouse | ENSMUSG00000021900 |
Gene ID - Rat | ENSRNOG00000019656 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BTD pAb (ATL-HPA052275) | |
Datasheet | Anti BTD pAb (ATL-HPA052275) Datasheet (External Link) |
Vendor Page | Anti BTD pAb (ATL-HPA052275) at Atlas Antibodies |
Documents & Links for Anti BTD pAb (ATL-HPA052275) | |
Datasheet | Anti BTD pAb (ATL-HPA052275) Datasheet (External Link) |
Vendor Page | Anti BTD pAb (ATL-HPA052275) |