Anti BTD pAb (ATL-HPA052275)

Atlas Antibodies

Catalog No.:
ATL-HPA052275-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: biotinidase
Gene Name: BTD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021900: 90%, ENSRNOG00000019656: 86%
Entrez Gene ID: 686
Uniprot ID: P43251
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVA
Gene Sequence NLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVA
Gene ID - Mouse ENSMUSG00000021900
Gene ID - Rat ENSRNOG00000019656
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BTD pAb (ATL-HPA052275)
Datasheet Anti BTD pAb (ATL-HPA052275) Datasheet (External Link)
Vendor Page Anti BTD pAb (ATL-HPA052275) at Atlas Antibodies

Documents & Links for Anti BTD pAb (ATL-HPA052275)
Datasheet Anti BTD pAb (ATL-HPA052275) Datasheet (External Link)
Vendor Page Anti BTD pAb (ATL-HPA052275)