Anti BTBD9 pAb (ATL-HPA041930)

Atlas Antibodies

SKU: ATL-HPA041930-25

• 
• 

Protein Description: BTB (POZ) domain containing 9
Gene Name: BTBD9
Alternative Gene Name: dJ322I12.1, KIAA1880
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062202: 99%, ENSRNOG00000000540: 99%
Entrez Gene ID: 114781
Uniprot ID: Q96Q07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDR
• Gene Sequence: ILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDR
• Gene ID - Mouse: ENSMUSG00000062202
• Gene ID - Rat: ENSRNOG00000000540
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.