Anti BTBD9 pAb (ATL-HPA041930)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041930-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BTBD9
Alternative Gene Name: dJ322I12.1, KIAA1880
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062202: 99%, ENSRNOG00000000540: 99%
Entrez Gene ID: 114781
Uniprot ID: Q96Q07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDR |
Gene Sequence | ILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDR |
Gene ID - Mouse | ENSMUSG00000062202 |
Gene ID - Rat | ENSRNOG00000000540 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BTBD9 pAb (ATL-HPA041930) | |
Datasheet | Anti BTBD9 pAb (ATL-HPA041930) Datasheet (External Link) |
Vendor Page | Anti BTBD9 pAb (ATL-HPA041930) at Atlas Antibodies |
Documents & Links for Anti BTBD9 pAb (ATL-HPA041930) | |
Datasheet | Anti BTBD9 pAb (ATL-HPA041930) Datasheet (External Link) |
Vendor Page | Anti BTBD9 pAb (ATL-HPA041930) |