Anti BTBD9 pAb (ATL-HPA041930)

Atlas Antibodies

Catalog No.:
ATL-HPA041930-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: BTB (POZ) domain containing 9
Gene Name: BTBD9
Alternative Gene Name: dJ322I12.1, KIAA1880
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062202: 99%, ENSRNOG00000000540: 99%
Entrez Gene ID: 114781
Uniprot ID: Q96Q07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDR
Gene Sequence ILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDR
Gene ID - Mouse ENSMUSG00000062202
Gene ID - Rat ENSRNOG00000000540
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BTBD9 pAb (ATL-HPA041930)
Datasheet Anti BTBD9 pAb (ATL-HPA041930) Datasheet (External Link)
Vendor Page Anti BTBD9 pAb (ATL-HPA041930) at Atlas Antibodies

Documents & Links for Anti BTBD9 pAb (ATL-HPA041930)
Datasheet Anti BTBD9 pAb (ATL-HPA041930) Datasheet (External Link)
Vendor Page Anti BTBD9 pAb (ATL-HPA041930)