Anti BTBD7 pAb (ATL-HPA049926 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA049926-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: BTB (POZ) domain containing 7
Gene Name: BTBD7
Alternative Gene Name: FLJ10648, FUP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041702: 98%, ENSRNOG00000008598: 99%
Entrez Gene ID: 55727
Uniprot ID: Q9P203
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLHYLYTGEFGMEDSRFQNVDILVQLSEEFGTPNSLDVDMRGLFDYMCYYDVVLSFSSDSELVEAFGGNQNCLDEELKAHKAVISARSPFFRNLLQRRIRTGEE
Gene Sequence LLHYLYTGEFGMEDSRFQNVDILVQLSEEFGTPNSLDVDMRGLFDYMCYYDVVLSFSSDSELVEAFGGNQNCLDEELKAHKAVISARSPFFRNLLQRRIRTGEE
Gene ID - Mouse ENSMUSG00000041702
Gene ID - Rat ENSRNOG00000008598
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BTBD7 pAb (ATL-HPA049926 w/enhanced validation)
Datasheet Anti BTBD7 pAb (ATL-HPA049926 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BTBD7 pAb (ATL-HPA049926 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BTBD7 pAb (ATL-HPA049926 w/enhanced validation)
Datasheet Anti BTBD7 pAb (ATL-HPA049926 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BTBD7 pAb (ATL-HPA049926 w/enhanced validation)