Anti BTBD18 pAb (ATL-HPA049325)

Atlas Antibodies

Catalog No.:
ATL-HPA049325-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: BTB (POZ) domain containing 18
Gene Name: BTBD18
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000086598: 68%, ENSRNOG00000043106: 68%
Entrez Gene ID: 643376
Uniprot ID: B2RXH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPSEVSEVLSVGGRWTPDLEITSSQPLDGQEDKLLHVSSLDTPQRSYGDLSPPCSNWVETGLEVSLTTDELLYPSPKAGKEVSGHSELLGSLPASS
Gene Sequence MPSEVSEVLSVGGRWTPDLEITSSQPLDGQEDKLLHVSSLDTPQRSYGDLSPPCSNWVETGLEVSLTTDELLYPSPKAGKEVSGHSELLGSLPASS
Gene ID - Mouse ENSMUSG00000086598
Gene ID - Rat ENSRNOG00000043106
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BTBD18 pAb (ATL-HPA049325)
Datasheet Anti BTBD18 pAb (ATL-HPA049325) Datasheet (External Link)
Vendor Page Anti BTBD18 pAb (ATL-HPA049325) at Atlas Antibodies

Documents & Links for Anti BTBD18 pAb (ATL-HPA049325)
Datasheet Anti BTBD18 pAb (ATL-HPA049325) Datasheet (External Link)
Vendor Page Anti BTBD18 pAb (ATL-HPA049325)