Anti BTBD18 pAb (ATL-HPA049325)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049325-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: BTBD18
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000086598: 68%, ENSRNOG00000043106: 68%
Entrez Gene ID: 643376
Uniprot ID: B2RXH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MPSEVSEVLSVGGRWTPDLEITSSQPLDGQEDKLLHVSSLDTPQRSYGDLSPPCSNWVETGLEVSLTTDELLYPSPKAGKEVSGHSELLGSLPASS |
| Gene Sequence | MPSEVSEVLSVGGRWTPDLEITSSQPLDGQEDKLLHVSSLDTPQRSYGDLSPPCSNWVETGLEVSLTTDELLYPSPKAGKEVSGHSELLGSLPASS |
| Gene ID - Mouse | ENSMUSG00000086598 |
| Gene ID - Rat | ENSRNOG00000043106 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BTBD18 pAb (ATL-HPA049325) | |
| Datasheet | Anti BTBD18 pAb (ATL-HPA049325) Datasheet (External Link) |
| Vendor Page | Anti BTBD18 pAb (ATL-HPA049325) at Atlas Antibodies |
| Documents & Links for Anti BTBD18 pAb (ATL-HPA049325) | |
| Datasheet | Anti BTBD18 pAb (ATL-HPA049325) Datasheet (External Link) |
| Vendor Page | Anti BTBD18 pAb (ATL-HPA049325) |