Anti BTBD17 pAb (ATL-HPA025022)

Atlas Antibodies

SKU: ATL-HPA025022-25

• 

Protein Description: BTB (POZ) domain containing 17
Gene Name: BTBD17
Alternative Gene Name: BTBD17A, LGALS3BPL, TANGO10A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000202: 98%, ENSRNOG00000003109: 97%
Entrez Gene ID: 388419
Uniprot ID: A6NE02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VADLLLQAYQFHAASPLHYAKFFDVNGSAFLPRNYLAPAWGAPWVINNPARDDRSTSFQTQLGPSGHDAGRRVTWNVLFSPRWLPVSLRPV
• Gene Sequence: VADLLLQAYQFHAASPLHYAKFFDVNGSAFLPRNYLAPAWGAPWVINNPARDDRSTSFQTQLGPSGHDAGRRVTWNVLFSPRWLPVSLRPV
• Gene ID - Mouse: ENSMUSG00000000202
• Gene ID - Rat: ENSRNOG00000003109
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.