Anti BTBD16 pAb (ATL-HPA040529)

Atlas Antibodies

Catalog No.: ATL-HPA040529-25

Protein Description: BTB (POZ) domain containing 16
Gene Name: BTBD16
Alternative Gene Name: C10orf87, Em:AC061711.1, FLJ25359
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040298: 74%, ENSRNOG00000036675: 74%
Entrez Gene ID: 118663
Uniprot ID: Q32M84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FLDRDIGRSLRPLFLCLRLHGITKGKDLEVLRHLNFFPESWLDQVTVNHYHALENGGDMVHLKDLNTQAVRFGLLFNQENTTYSKTIALYGFFFK
• Gene Sequence: FLDRDIGRSLRPLFLCLRLHGITKGKDLEVLRHLNFFPESWLDQVTVNHYHALENGGDMVHLKDLNTQAVRFGLLFNQENTTYSKTIALYGFFFK
• Gene ID - Mouse: ENSMUSG00000040298
• Gene ID - Rat: ENSRNOG00000036675
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.