Anti BTBD16 pAb (ATL-HPA040529)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040529-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BTBD16
Alternative Gene Name: C10orf87, Em:AC061711.1, FLJ25359
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040298: 74%, ENSRNOG00000036675: 74%
Entrez Gene ID: 118663
Uniprot ID: Q32M84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FLDRDIGRSLRPLFLCLRLHGITKGKDLEVLRHLNFFPESWLDQVTVNHYHALENGGDMVHLKDLNTQAVRFGLLFNQENTTYSKTIALYGFFFK |
Gene Sequence | FLDRDIGRSLRPLFLCLRLHGITKGKDLEVLRHLNFFPESWLDQVTVNHYHALENGGDMVHLKDLNTQAVRFGLLFNQENTTYSKTIALYGFFFK |
Gene ID - Mouse | ENSMUSG00000040298 |
Gene ID - Rat | ENSRNOG00000036675 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BTBD16 pAb (ATL-HPA040529) | |
Datasheet | Anti BTBD16 pAb (ATL-HPA040529) Datasheet (External Link) |
Vendor Page | Anti BTBD16 pAb (ATL-HPA040529) at Atlas Antibodies |
Documents & Links for Anti BTBD16 pAb (ATL-HPA040529) | |
Datasheet | Anti BTBD16 pAb (ATL-HPA040529) Datasheet (External Link) |
Vendor Page | Anti BTBD16 pAb (ATL-HPA040529) |