Anti BTBD16 pAb (ATL-HPA040529)

Atlas Antibodies

Catalog No.:
ATL-HPA040529-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: BTB (POZ) domain containing 16
Gene Name: BTBD16
Alternative Gene Name: C10orf87, Em:AC061711.1, FLJ25359
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040298: 74%, ENSRNOG00000036675: 74%
Entrez Gene ID: 118663
Uniprot ID: Q32M84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLDRDIGRSLRPLFLCLRLHGITKGKDLEVLRHLNFFPESWLDQVTVNHYHALENGGDMVHLKDLNTQAVRFGLLFNQENTTYSKTIALYGFFFK
Gene Sequence FLDRDIGRSLRPLFLCLRLHGITKGKDLEVLRHLNFFPESWLDQVTVNHYHALENGGDMVHLKDLNTQAVRFGLLFNQENTTYSKTIALYGFFFK
Gene ID - Mouse ENSMUSG00000040298
Gene ID - Rat ENSRNOG00000036675
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BTBD16 pAb (ATL-HPA040529)
Datasheet Anti BTBD16 pAb (ATL-HPA040529) Datasheet (External Link)
Vendor Page Anti BTBD16 pAb (ATL-HPA040529) at Atlas Antibodies

Documents & Links for Anti BTBD16 pAb (ATL-HPA040529)
Datasheet Anti BTBD16 pAb (ATL-HPA040529) Datasheet (External Link)
Vendor Page Anti BTBD16 pAb (ATL-HPA040529)