Anti BTBD11 pAb (ATL-HPA061334)

Atlas Antibodies

SKU:
ATL-HPA061334-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: BTB domain containing 11
Gene Name: BTBD11
Alternative Gene Name: ABTB2B, FLJ33957
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020042: 98%, ENSRNOG00000005758: 98%
Entrez Gene ID: 121551
Uniprot ID: A6QL63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AMHHLQPLNAKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQMEWENPNVEPSKVNLQVERP
Gene Sequence AMHHLQPLNAKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQMEWENPNVEPSKVNLQVERP
Gene ID - Mouse ENSMUSG00000020042
Gene ID - Rat ENSRNOG00000005758
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BTBD11 pAb (ATL-HPA061334)
Datasheet Anti BTBD11 pAb (ATL-HPA061334) Datasheet (External Link)
Vendor Page Anti BTBD11 pAb (ATL-HPA061334) at Atlas Antibodies

Documents & Links for Anti BTBD11 pAb (ATL-HPA061334)
Datasheet Anti BTBD11 pAb (ATL-HPA061334) Datasheet (External Link)
Vendor Page Anti BTBD11 pAb (ATL-HPA061334)