Anti BTBD11 pAb (ATL-HPA061334)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061334-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: BTBD11
Alternative Gene Name: ABTB2B, FLJ33957
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020042: 98%, ENSRNOG00000005758: 98%
Entrez Gene ID: 121551
Uniprot ID: A6QL63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AMHHLQPLNAKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQMEWENPNVEPSKVNLQVERP |
| Gene Sequence | AMHHLQPLNAKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQMEWENPNVEPSKVNLQVERP |
| Gene ID - Mouse | ENSMUSG00000020042 |
| Gene ID - Rat | ENSRNOG00000005758 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BTBD11 pAb (ATL-HPA061334) | |
| Datasheet | Anti BTBD11 pAb (ATL-HPA061334) Datasheet (External Link) |
| Vendor Page | Anti BTBD11 pAb (ATL-HPA061334) at Atlas Antibodies |
| Documents & Links for Anti BTBD11 pAb (ATL-HPA061334) | |
| Datasheet | Anti BTBD11 pAb (ATL-HPA061334) Datasheet (External Link) |
| Vendor Page | Anti BTBD11 pAb (ATL-HPA061334) |