Anti BTBD11 pAb (ATL-HPA061334)
Atlas Antibodies
- SKU:
- ATL-HPA061334-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BTBD11
Alternative Gene Name: ABTB2B, FLJ33957
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020042: 98%, ENSRNOG00000005758: 98%
Entrez Gene ID: 121551
Uniprot ID: A6QL63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AMHHLQPLNAKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQMEWENPNVEPSKVNLQVERP |
Gene Sequence | AMHHLQPLNAKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQMEWENPNVEPSKVNLQVERP |
Gene ID - Mouse | ENSMUSG00000020042 |
Gene ID - Rat | ENSRNOG00000005758 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BTBD11 pAb (ATL-HPA061334) | |
Datasheet | Anti BTBD11 pAb (ATL-HPA061334) Datasheet (External Link) |
Vendor Page | Anti BTBD11 pAb (ATL-HPA061334) at Atlas Antibodies |
Documents & Links for Anti BTBD11 pAb (ATL-HPA061334) | |
Datasheet | Anti BTBD11 pAb (ATL-HPA061334) Datasheet (External Link) |
Vendor Page | Anti BTBD11 pAb (ATL-HPA061334) |