Anti BTBD1 pAb (ATL-HPA024263)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024263-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: BTBD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025103: 98%, ENSRNOG00000019529: 98%
Entrez Gene ID: 53339
Uniprot ID: Q9H0C5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSPSSLGPLLPLQREPLYNWQATKASLKERFAFLFNSELLSDVRFVLGKG |
| Gene Sequence | PSPSSLGPLLPLQREPLYNWQATKASLKERFAFLFNSELLSDVRFVLGKG |
| Gene ID - Mouse | ENSMUSG00000025103 |
| Gene ID - Rat | ENSRNOG00000019529 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BTBD1 pAb (ATL-HPA024263) | |
| Datasheet | Anti BTBD1 pAb (ATL-HPA024263) Datasheet (External Link) |
| Vendor Page | Anti BTBD1 pAb (ATL-HPA024263) at Atlas Antibodies |
| Documents & Links for Anti BTBD1 pAb (ATL-HPA024263) | |
| Datasheet | Anti BTBD1 pAb (ATL-HPA024263) Datasheet (External Link) |
| Vendor Page | Anti BTBD1 pAb (ATL-HPA024263) |