Anti BTAF1 pAb (ATL-HPA070682)

Atlas Antibodies

SKU:
ATL-HPA070682-25
  • Immunofluorescent staining of human cell line HaCaT shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa
Gene Name: BTAF1
Alternative Gene Name: MOT1, TAF(II)170, TAF-172, TAF172, TAFII170
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040565: 99%, ENSRNOG00000017938: 99%
Entrez Gene ID: 9044
Uniprot ID: O14981
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVDETVSSATLS
Gene Sequence QFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVDETVSSATLS
Gene ID - Mouse ENSMUSG00000040565
Gene ID - Rat ENSRNOG00000017938
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BTAF1 pAb (ATL-HPA070682)
Datasheet Anti BTAF1 pAb (ATL-HPA070682) Datasheet (External Link)
Vendor Page Anti BTAF1 pAb (ATL-HPA070682) at Atlas Antibodies

Documents & Links for Anti BTAF1 pAb (ATL-HPA070682)
Datasheet Anti BTAF1 pAb (ATL-HPA070682) Datasheet (External Link)
Vendor Page Anti BTAF1 pAb (ATL-HPA070682)