Anti BST2 pAb (ATL-HPA017060)

Atlas Antibodies

Catalog No.:
ATL-HPA017060-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: bone marrow stromal cell antigen 2
Gene Name: BST2
Alternative Gene Name: CD317, tetherin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068876: 29%, ENSRNOG00000019688: 29%
Entrez Gene ID: 684
Uniprot ID: Q10589
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen THLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLG
Gene Sequence THLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLG
Gene ID - Mouse ENSMUSG00000068876
Gene ID - Rat ENSRNOG00000019688
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BST2 pAb (ATL-HPA017060)
Datasheet Anti BST2 pAb (ATL-HPA017060) Datasheet (External Link)
Vendor Page Anti BST2 pAb (ATL-HPA017060) at Atlas Antibodies

Documents & Links for Anti BST2 pAb (ATL-HPA017060)
Datasheet Anti BST2 pAb (ATL-HPA017060) Datasheet (External Link)
Vendor Page Anti BST2 pAb (ATL-HPA017060)
Citations for Anti BST2 pAb (ATL-HPA017060) – 3 Found
Shigematsu, Yoshinori; Oue, Naohide; Nishioka, Yuri; Sakamoto, Naoya; Sentani, Kazuhiro; Sekino, Yohei; Mukai, Shoichiro; Teishima, Jun; Matsubara, Akio; Yasui, Wataru. Overexpression of the transmembrane protein BST-2 induces Akt and Erk phosphorylation in bladder cancer. Oncology Letters. 2017;14(1):999-1004.  PubMed
Chiang, Sum-Fu; Kan, Chih-Yen; Hsiao, Yung-Chin; Tang, Reiping; Hsieh, Ling-Ling; Chiang, Jy-Ming; Tsai, Wen-Sy; Yeh, Chien-Yuh; Hsieh, Pao-Shiu; Liang, Ying; Chen, Jinn-Shiun; Yu, Jau-Song. Bone Marrow Stromal Antigen 2 Is a Novel Plasma Biomarker and Prognosticator for Colorectal Carcinoma: A Secretome-Based Verification Study. Disease Markers. 2015( 26494939):874054.  PubMed
Deleage, Claire; Immonen, Taina T; Fennessey, Christine M; Reynaldi, Arnold; Reid, Carolyn; Newman, Laura; Lipkey, Leslie; Schlub, Timothy E; Camus, Celine; O'Brien, Sean; Smedley, Jeremy; Conway, Jessica M; Del Prete, Gregory Q; Davenport, Miles P; Lifson, Jeffrey D; Estes, Jacob D; Keele, Brandon F. Defining early SIV replication and dissemination dynamics following vaginal transmission. Science Advances. 2019;5(5):eaav7116.  PubMed