Anti BSPRY pAb (ATL-HPA077485)

Atlas Antibodies

Catalog No.:
ATL-HPA077485-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: B-box and SPRY domain containing
Gene Name: BSPRY
Alternative Gene Name: FLJ20150
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028392: 82%, ENSRNOG00000015105: 75%
Entrez Gene ID: 54836
Uniprot ID: Q5W0U4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEI
Gene Sequence VADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEI
Gene ID - Mouse ENSMUSG00000028392
Gene ID - Rat ENSRNOG00000015105
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BSPRY pAb (ATL-HPA077485)
Datasheet Anti BSPRY pAb (ATL-HPA077485) Datasheet (External Link)
Vendor Page Anti BSPRY pAb (ATL-HPA077485) at Atlas Antibodies

Documents & Links for Anti BSPRY pAb (ATL-HPA077485)
Datasheet Anti BSPRY pAb (ATL-HPA077485) Datasheet (External Link)
Vendor Page Anti BSPRY pAb (ATL-HPA077485)