Anti BSG pAb (ATL-HPA036048 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA036048-25

• 
• 

Protein Description: basigin (Ok blood group)
Gene Name: BSG
Alternative Gene Name: CD147, EMMPRIN, OK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023175: 51%, ENSRNOG00000008414: 50%
Entrez Gene ID: 682
Uniprot ID: P35613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIEN
• Gene Sequence: DLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIEN
• Gene ID - Mouse: ENSMUSG00000023175
• Gene ID - Rat: ENSRNOG00000008414
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BSG pAb (ATL-HPA036048 w/enhanced validation) – 1 Found

Gao, Li; Zhong, Jin-Cai; Huang, Wen-Ting; Dang, Yi-Wu; Kang, Min; Chen, Gang. Integrative analysis of BSG expression in NPC through immunohistochemistry and public high-throughput gene expression data. American Journal Of Translational Research. 9(10):4574-4592.