Anti BSG pAb (ATL-HPA036048 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036048-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: BSG
Alternative Gene Name: CD147, EMMPRIN, OK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023175: 51%, ENSRNOG00000008414: 50%
Entrez Gene ID: 682
Uniprot ID: P35613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIEN |
| Gene Sequence | DLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIEN |
| Gene ID - Mouse | ENSMUSG00000023175 |
| Gene ID - Rat | ENSRNOG00000008414 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BSG pAb (ATL-HPA036048 w/enhanced validation) | |
| Datasheet | Anti BSG pAb (ATL-HPA036048 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BSG pAb (ATL-HPA036048 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BSG pAb (ATL-HPA036048 w/enhanced validation) | |
| Datasheet | Anti BSG pAb (ATL-HPA036048 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BSG pAb (ATL-HPA036048 w/enhanced validation) |
| Citations for Anti BSG pAb (ATL-HPA036048 w/enhanced validation) – 1 Found |
| Gao, Li; Zhong, Jin-Cai; Huang, Wen-Ting; Dang, Yi-Wu; Kang, Min; Chen, Gang. Integrative analysis of BSG expression in NPC through immunohistochemistry and public high-throughput gene expression data. American Journal Of Translational Research. 9(10):4574-4592. PubMed |