Anti BSDC1 pAb (ATL-HPA031358 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA031358-25

• 
• 
• 

Protein Description: BSD domain containing 1
Gene Name: BSDC1
Alternative Gene Name: FLJ10276, RP4-811H24.7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040859: 61%, ENSRNOG00000008338: 60%
Entrez Gene ID: 55108
Uniprot ID: Q9NW68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLRVFELNSDSGKSTPSNNGKKGSSTDISEDWEKDFDLDMTEEEVQMALSKVDASGEVSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCL
• Gene Sequence: DLRVFELNSDSGKSTPSNNGKKGSSTDISEDWEKDFDLDMTEEEVQMALSKVDASGEVSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCL
• Gene ID - Mouse: ENSMUSG00000040859
• Gene ID - Rat: ENSRNOG00000008338
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.