Anti BRWD1 pAb (ATL-HPA030944)

Atlas Antibodies

Catalog No.: ATL-HPA030944-25

Protein Description: bromodomain and WD repeat domain containing 1
Gene Name: BRWD1
Alternative Gene Name: C21orf107, FLJ11315, N143, WDR9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022914: 77%, ENSRNOG00000001632: 70%
Entrez Gene ID: 54014
Uniprot ID: Q9NSI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TKVRTCMHNQKDAVQMPSETLKAKMVPEKVPRRCATVAANKIKIMSNLKETISGPENVWIRKSSRKLPHRN
• Gene Sequence: TKVRTCMHNQKDAVQMPSETLKAKMVPEKVPRRCATVAANKIKIMSNLKETISGPENVWIRKSSRKLPHRN
• Gene ID - Mouse: ENSMUSG00000022914
• Gene ID - Rat: ENSRNOG00000001632
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.