Anti BRWD1 pAb (ATL-HPA030944)

Atlas Antibodies

Catalog No.:
ATL-HPA030944-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: bromodomain and WD repeat domain containing 1
Gene Name: BRWD1
Alternative Gene Name: C21orf107, FLJ11315, N143, WDR9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022914: 77%, ENSRNOG00000001632: 70%
Entrez Gene ID: 54014
Uniprot ID: Q9NSI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TKVRTCMHNQKDAVQMPSETLKAKMVPEKVPRRCATVAANKIKIMSNLKETISGPENVWIRKSSRKLPHRN
Gene Sequence TKVRTCMHNQKDAVQMPSETLKAKMVPEKVPRRCATVAANKIKIMSNLKETISGPENVWIRKSSRKLPHRN
Gene ID - Mouse ENSMUSG00000022914
Gene ID - Rat ENSRNOG00000001632
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BRWD1 pAb (ATL-HPA030944)
Datasheet Anti BRWD1 pAb (ATL-HPA030944) Datasheet (External Link)
Vendor Page Anti BRWD1 pAb (ATL-HPA030944) at Atlas Antibodies

Documents & Links for Anti BRWD1 pAb (ATL-HPA030944)
Datasheet Anti BRWD1 pAb (ATL-HPA030944) Datasheet (External Link)
Vendor Page Anti BRWD1 pAb (ATL-HPA030944)