Anti BRSK1 pAb (ATL-HPA061719)

Atlas Antibodies

Catalog No.:
ATL-HPA061719-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: BR serine/threonine kinase 1
Gene Name: BRSK1
Alternative Gene Name: KIAA1811
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035390: 100%, ENSRNOG00000017673: 100%
Entrez Gene ID: 84446
Uniprot ID: Q8TDC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEPEKRLSLEQIQKHPWYLGGKHEPDPCLEPAPGRRVAMRSLPSNGELDPD
Gene Sequence VEPEKRLSLEQIQKHPWYLGGKHEPDPCLEPAPGRRVAMRSLPSNGELDPD
Gene ID - Mouse ENSMUSG00000035390
Gene ID - Rat ENSRNOG00000017673
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BRSK1 pAb (ATL-HPA061719)
Datasheet Anti BRSK1 pAb (ATL-HPA061719) Datasheet (External Link)
Vendor Page Anti BRSK1 pAb (ATL-HPA061719) at Atlas Antibodies

Documents & Links for Anti BRSK1 pAb (ATL-HPA061719)
Datasheet Anti BRSK1 pAb (ATL-HPA061719) Datasheet (External Link)
Vendor Page Anti BRSK1 pAb (ATL-HPA061719)
Citations for Anti BRSK1 pAb (ATL-HPA061719) – 1 Found
Dhumale, Pratibha; Menon, Sindhu; Chiang, Joanna; Püschel, Andreas W. The loss of the kinases SadA and SadB results in early neuronal apoptosis and a reduced number of progenitors. Plos One. 13(4):e0196698.  PubMed