Anti BRSK1 pAb (ATL-HPA061719)

Atlas Antibodies

SKU: ATL-HPA061719-25

• 
• 

Protein Description: BR serine/threonine kinase 1
Gene Name: BRSK1
Alternative Gene Name: KIAA1811
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035390: 100%, ENSRNOG00000017673: 100%
Entrez Gene ID: 84446
Uniprot ID: Q8TDC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEPEKRLSLEQIQKHPWYLGGKHEPDPCLEPAPGRRVAMRSLPSNGELDPD
• Gene Sequence: VEPEKRLSLEQIQKHPWYLGGKHEPDPCLEPAPGRRVAMRSLPSNGELDPD
• Gene ID - Mouse: ENSMUSG00000035390
• Gene ID - Rat: ENSRNOG00000017673
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BRSK1 pAb (ATL-HPA061719) – 1 Found

Dhumale, Pratibha; Menon, Sindhu; Chiang, Joanna; Püschel, Andreas W. The loss of the kinases SadA and SadB results in early neuronal apoptosis and a reduced number of progenitors. Plos One. 13(4):e0196698.