Anti BRPF3 pAb (ATL-HPA022787)

Atlas Antibodies

SKU:
ATL-HPA022787-25
  • Immunohistochemical staining of human stomach shows strong positivity in mucous cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: bromodomain and PHD finger containing, 3
Gene Name: BRPF3
Alternative Gene Name: KIAA1286
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063952: 83%, ENSRNOG00000028641: 82%
Entrez Gene ID: 27154
Uniprot ID: Q9ULD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDNGINRLSLMAPDTPAGTPLSGVGRRTSVLFKKAKNGVKLQRSPDRVLENGEDHGVAGSPASPASIEEERHSRKRPRSRSCSESEGERSPQQEEETGMTNGFGKHTESGSDSECSLGLSGGLAFEACSGLTPPKRSRG
Gene Sequence SDNGINRLSLMAPDTPAGTPLSGVGRRTSVLFKKAKNGVKLQRSPDRVLENGEDHGVAGSPASPASIEEERHSRKRPRSRSCSESEGERSPQQEEETGMTNGFGKHTESGSDSECSLGLSGGLAFEACSGLTPPKRSRG
Gene ID - Mouse ENSMUSG00000063952
Gene ID - Rat ENSRNOG00000028641
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BRPF3 pAb (ATL-HPA022787)
Datasheet Anti BRPF3 pAb (ATL-HPA022787) Datasheet (External Link)
Vendor Page Anti BRPF3 pAb (ATL-HPA022787) at Atlas Antibodies

Documents & Links for Anti BRPF3 pAb (ATL-HPA022787)
Datasheet Anti BRPF3 pAb (ATL-HPA022787) Datasheet (External Link)
Vendor Page Anti BRPF3 pAb (ATL-HPA022787)