Anti BROX pAb (ATL-HPA031445)

Atlas Antibodies

SKU:
ATL-HPA031445-25
  • Immunohistochemical staining of human urinary bladder shows distinct nuclear and cytoplasmic positivity in urothelial cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & the Golgi apparatus.
  • Western blot analysis in human cell line CAPAN-2.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: BRO1 domain and CAAX motif containing
Gene Name: BROX
Alternative Gene Name: C1orf58, FLJ32421
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046836: 88%, ENSRNOG00000052963: 90%
Entrez Gene ID: 148362
Uniprot ID: Q5VW32
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGNLVKNTLEKCQRENGFIYFQKIPTEAPQLELKANYGLVEPIPFEFPPTSVQWTPETLAAFDLTKRPKDDSTKPKPEEEVKPVKEPDIKPQKDTGCYIS
Gene Sequence LGNLVKNTLEKCQRENGFIYFQKIPTEAPQLELKANYGLVEPIPFEFPPTSVQWTPETLAAFDLTKRPKDDSTKPKPEEEVKPVKEPDIKPQKDTGCYIS
Gene ID - Mouse ENSMUSG00000046836
Gene ID - Rat ENSRNOG00000052963
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BROX pAb (ATL-HPA031445)
Datasheet Anti BROX pAb (ATL-HPA031445) Datasheet (External Link)
Vendor Page Anti BROX pAb (ATL-HPA031445) at Atlas Antibodies

Documents & Links for Anti BROX pAb (ATL-HPA031445)
Datasheet Anti BROX pAb (ATL-HPA031445) Datasheet (External Link)
Vendor Page Anti BROX pAb (ATL-HPA031445)