Anti BRMS1 pAb (ATL-HPA019637)

Atlas Antibodies

Catalog No.:
ATL-HPA019637-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: breast cancer metastasis suppressor 1
Gene Name: BRMS1
Alternative Gene Name: DKFZP564A063
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000080268: 89%, ENSRNOG00000047683: 93%
Entrez Gene ID: 25855
Uniprot ID: Q9HCU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSGPYIVYMLQEIDILEDWTAIKKARAAVSPQK
Gene Sequence KLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSGPYIVYMLQEIDILEDWTAIKKARAAVSPQK
Gene ID - Mouse ENSMUSG00000080268
Gene ID - Rat ENSRNOG00000047683
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BRMS1 pAb (ATL-HPA019637)
Datasheet Anti BRMS1 pAb (ATL-HPA019637) Datasheet (External Link)
Vendor Page Anti BRMS1 pAb (ATL-HPA019637) at Atlas Antibodies

Documents & Links for Anti BRMS1 pAb (ATL-HPA019637)
Datasheet Anti BRMS1 pAb (ATL-HPA019637) Datasheet (External Link)
Vendor Page Anti BRMS1 pAb (ATL-HPA019637)