Anti BRK1 pAb (ATL-HPA060391)

Atlas Antibodies

Catalog No.:
ATL-HPA060391-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: BRICK1, SCAR/WAVE actin-nucleating complex subunit
Gene Name: BRK1
Alternative Gene Name: C3orf10, HSPC300, MDS027
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033940: 99%, ENSRNOG00000010184: 99%
Entrez Gene ID: 55845
Uniprot ID: Q8WUW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVT
Gene Sequence MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVT
Gene ID - Mouse ENSMUSG00000033940
Gene ID - Rat ENSRNOG00000010184
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BRK1 pAb (ATL-HPA060391)
Datasheet Anti BRK1 pAb (ATL-HPA060391) Datasheet (External Link)
Vendor Page Anti BRK1 pAb (ATL-HPA060391) at Atlas Antibodies

Documents & Links for Anti BRK1 pAb (ATL-HPA060391)
Datasheet Anti BRK1 pAb (ATL-HPA060391) Datasheet (External Link)
Vendor Page Anti BRK1 pAb (ATL-HPA060391)