Anti BRIX1 pAb (ATL-HPA039614)

Atlas Antibodies

Catalog No.:
ATL-HPA039614-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: BRX1, biogenesis of ribosomes, homolog (S. cerevisiae)
Gene Name: BRIX1
Alternative Gene Name: BRIX, BXDC2, FLJ11100
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022247: 94%, ENSRNOG00000018021: 95%
Entrez Gene ID: 55299
Uniprot ID: Q8TDN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LYENPHYQSPNMHRRVIRSITAAKYREKQQVKDVQKLRKKEPKTLLPHDPTADVFVTPAEEKPIEIQWVKPEPKVDLKARKKRIYK
Gene Sequence LYENPHYQSPNMHRRVIRSITAAKYREKQQVKDVQKLRKKEPKTLLPHDPTADVFVTPAEEKPIEIQWVKPEPKVDLKARKKRIYK
Gene ID - Mouse ENSMUSG00000022247
Gene ID - Rat ENSRNOG00000018021
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BRIX1 pAb (ATL-HPA039614)
Datasheet Anti BRIX1 pAb (ATL-HPA039614) Datasheet (External Link)
Vendor Page Anti BRIX1 pAb (ATL-HPA039614) at Atlas Antibodies

Documents & Links for Anti BRIX1 pAb (ATL-HPA039614)
Datasheet Anti BRIX1 pAb (ATL-HPA039614) Datasheet (External Link)
Vendor Page Anti BRIX1 pAb (ATL-HPA039614)