Anti BRIX1 pAb (ATL-HPA039614)

Atlas Antibodies

SKU: ATL-HPA039614-25

• 
• 
• 

Protein Description: BRX1, biogenesis of ribosomes, homolog (S. cerevisiae)
Gene Name: BRIX1
Alternative Gene Name: BRIX, BXDC2, FLJ11100
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022247: 94%, ENSRNOG00000018021: 95%
Entrez Gene ID: 55299
Uniprot ID: Q8TDN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LYENPHYQSPNMHRRVIRSITAAKYREKQQVKDVQKLRKKEPKTLLPHDPTADVFVTPAEEKPIEIQWVKPEPKVDLKARKKRIYK
• Gene Sequence: LYENPHYQSPNMHRRVIRSITAAKYREKQQVKDVQKLRKKEPKTLLPHDPTADVFVTPAEEKPIEIQWVKPEPKVDLKARKKRIYK
• Gene ID - Mouse: ENSMUSG00000022247
• Gene ID - Rat: ENSRNOG00000018021
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.