Anti BRIP1 pAb (ATL-HPA005474 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA005474-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & nuclear membrane.
  • Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-BRIP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: BRCA1 interacting protein C-terminal helicase 1
Gene Name: BRIP1
Alternative Gene Name: BACH1, FANCJ, OF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034329: 47%, ENSRNOG00000059997: 47%
Entrez Gene ID: 83990
Uniprot ID: Q9BX63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FNKQTKRVSWSSFNSLGQYFTGKIPKATPELGSSENSASSPPRFKTEKMESKTVLPFTDKCESSNLTVNTSFGSCPQSETIISSLKIDATLTRKNHSEHPLCSEEALDPDIELSLVSEEDKQSTSNRDFETEAEDESIYFTPEL
Gene Sequence FNKQTKRVSWSSFNSLGQYFTGKIPKATPELGSSENSASSPPRFKTEKMESKTVLPFTDKCESSNLTVNTSFGSCPQSETIISSLKIDATLTRKNHSEHPLCSEEALDPDIELSLVSEEDKQSTSNRDFETEAEDESIYFTPEL
Gene ID - Mouse ENSMUSG00000034329
Gene ID - Rat ENSRNOG00000059997
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BRIP1 pAb (ATL-HPA005474 w/enhanced validation)
Datasheet Anti BRIP1 pAb (ATL-HPA005474 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BRIP1 pAb (ATL-HPA005474 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BRIP1 pAb (ATL-HPA005474 w/enhanced validation)
Datasheet Anti BRIP1 pAb (ATL-HPA005474 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BRIP1 pAb (ATL-HPA005474 w/enhanced validation)



Citations for Anti BRIP1 pAb (ATL-HPA005474 w/enhanced validation) – 1 Found
Zou, Wei; Ma, Xiangdong; Hua, Wei; Chen, Biliang; Huang, Yanhong; Wang, Detang; Cai, Guoqing. BRIP1 inhibits the tumorigenic properties of cervical cancer by regulating RhoA GTPase activity. Oncology Letters. 2016;11(1):551-558.  PubMed