Anti BRINP2 pAb (ATL-HPA061920)
Atlas Antibodies
- SKU:
- ATL-HPA061920-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BRINP2
Alternative Gene Name: DBCCR1L2, FAM5B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004031: 95%, ENSRNOG00000005592: 95%
Entrez Gene ID: 57795
Uniprot ID: Q9C0B6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTFPECNCPDADIQAMEDSLLQIQDSWATHNRQFEESEEFQALLKRLPDDRFLNSTAISQFW |
| Gene Sequence | PTFPECNCPDADIQAMEDSLLQIQDSWATHNRQFEESEEFQALLKRLPDDRFLNSTAISQFW |
| Gene ID - Mouse | ENSMUSG00000004031 |
| Gene ID - Rat | ENSRNOG00000005592 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BRINP2 pAb (ATL-HPA061920) | |
| Datasheet | Anti BRINP2 pAb (ATL-HPA061920) Datasheet (External Link) |
| Vendor Page | Anti BRINP2 pAb (ATL-HPA061920) at Atlas Antibodies |
| Documents & Links for Anti BRINP2 pAb (ATL-HPA061920) | |
| Datasheet | Anti BRINP2 pAb (ATL-HPA061920) Datasheet (External Link) |
| Vendor Page | Anti BRINP2 pAb (ATL-HPA061920) |
| Citations for Anti BRINP2 pAb (ATL-HPA061920) – 1 Found |
| Apóstolo, Nuno; Smukowski, Samuel N; Vanderlinden, Jeroen; Condomitti, Giuseppe; Rybakin, Vasily; Ten Bos, Jolijn; Trobiani, Laura; Portegies, Sybren; Vennekens, Kristel M; Gounko, Natalia V; Comoletti, Davide; Wierda, Keimpe D; Savas, Jeffrey N; de Wit, Joris. Synapse type-specific proteomic dissection identifies IgSF8 as a hippocampal CA3 microcircuit organizer. Nature Communications. 2020;11(1):5171. PubMed |