Anti BRINP2 pAb (ATL-HPA061920)

Atlas Antibodies

Catalog No.: ATL-HPA061920-25

Protein Description: bone morphogenetic protein/retinoic acid inducible neural-specific 2
Gene Name: BRINP2
Alternative Gene Name: DBCCR1L2, FAM5B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004031: 95%, ENSRNOG00000005592: 95%
Entrez Gene ID: 57795
Uniprot ID: Q9C0B6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTFPECNCPDADIQAMEDSLLQIQDSWATHNRQFEESEEFQALLKRLPDDRFLNSTAISQFW
• Gene Sequence: PTFPECNCPDADIQAMEDSLLQIQDSWATHNRQFEESEEFQALLKRLPDDRFLNSTAISQFW
• Gene ID - Mouse: ENSMUSG00000004031
• Gene ID - Rat: ENSRNOG00000005592
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BRINP2 pAb (ATL-HPA061920) – 1 Found

Apóstolo, Nuno; Smukowski, Samuel N; Vanderlinden, Jeroen; Condomitti, Giuseppe; Rybakin, Vasily; Ten Bos, Jolijn; Trobiani, Laura; Portegies, Sybren; Vennekens, Kristel M; Gounko, Natalia V; Comoletti, Davide; Wierda, Keimpe D; Savas, Jeffrey N; de Wit, Joris. Synapse type-specific proteomic dissection identifies IgSF8 as a hippocampal CA3 microcircuit organizer. Nature Communications. 2020;11(1):5171.