Anti BRINP1 pAb (ATL-HPA038828)

Atlas Antibodies

SKU:
ATL-HPA038828-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine pancreas.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: bone morphogenetic protein/retinoic acid inducible neural-specific 1
Gene Name: BRINP1
Alternative Gene Name: DBC1, DBCCR1, FAM5A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028351: 98%, ENSRNOG00000005561: 98%
Entrez Gene ID: 1620
Uniprot ID: O60477
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLPTLLRNETGQGPVDLSDPSKRQFYIKISDVQVFGYSLRFNADLLRSAVQQVNQSYTQGGQFYSSSSVMLLLLDIRDRINRLAPPVAPGKPQLDLFSCMLKHRLKLTNSEIIRVNHALDLYNTEILKQSDQM
Gene Sequence RLPTLLRNETGQGPVDLSDPSKRQFYIKISDVQVFGYSLRFNADLLRSAVQQVNQSYTQGGQFYSSSSVMLLLLDIRDRINRLAPPVAPGKPQLDLFSCMLKHRLKLTNSEIIRVNHALDLYNTEILKQSDQM
Gene ID - Mouse ENSMUSG00000028351
Gene ID - Rat ENSRNOG00000005561
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BRINP1 pAb (ATL-HPA038828)
Datasheet Anti BRINP1 pAb (ATL-HPA038828) Datasheet (External Link)
Vendor Page Anti BRINP1 pAb (ATL-HPA038828) at Atlas Antibodies

Documents & Links for Anti BRINP1 pAb (ATL-HPA038828)
Datasheet Anti BRINP1 pAb (ATL-HPA038828) Datasheet (External Link)
Vendor Page Anti BRINP1 pAb (ATL-HPA038828)