Anti BRINP1 pAb (ATL-HPA038828)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038828-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BRINP1
Alternative Gene Name: DBC1, DBCCR1, FAM5A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028351: 98%, ENSRNOG00000005561: 98%
Entrez Gene ID: 1620
Uniprot ID: O60477
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RLPTLLRNETGQGPVDLSDPSKRQFYIKISDVQVFGYSLRFNADLLRSAVQQVNQSYTQGGQFYSSSSVMLLLLDIRDRINRLAPPVAPGKPQLDLFSCMLKHRLKLTNSEIIRVNHALDLYNTEILKQSDQM |
Gene Sequence | RLPTLLRNETGQGPVDLSDPSKRQFYIKISDVQVFGYSLRFNADLLRSAVQQVNQSYTQGGQFYSSSSVMLLLLDIRDRINRLAPPVAPGKPQLDLFSCMLKHRLKLTNSEIIRVNHALDLYNTEILKQSDQM |
Gene ID - Mouse | ENSMUSG00000028351 |
Gene ID - Rat | ENSRNOG00000005561 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BRINP1 pAb (ATL-HPA038828) | |
Datasheet | Anti BRINP1 pAb (ATL-HPA038828) Datasheet (External Link) |
Vendor Page | Anti BRINP1 pAb (ATL-HPA038828) at Atlas Antibodies |
Documents & Links for Anti BRINP1 pAb (ATL-HPA038828) | |
Datasheet | Anti BRINP1 pAb (ATL-HPA038828) Datasheet (External Link) |
Vendor Page | Anti BRINP1 pAb (ATL-HPA038828) |