Anti BRICD5 pAb (ATL-HPA063522)

Atlas Antibodies

Catalog No.: ATL-HPA063522-25

Protein Description: BRICHOS domain containing 5
Gene Name: BRICD5
Alternative Gene Name: C16orf79, MGC21830
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045744: 63%, ENSRNOG00000009611: 71%
Entrez Gene ID: 283870
Uniprot ID: Q6PL45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLEVDPAQAGALVQRLCMRTPIYWARRAEGPRRQRLIY
• Gene Sequence: SLEVDPAQAGALVQRLCMRTPIYWARRAEGPRRQRLIY
• Gene ID - Mouse: ENSMUSG00000045744
• Gene ID - Rat: ENSRNOG00000009611
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.