Anti BRI3BP pAb (ATL-HPA014957)

Atlas Antibodies

SKU: ATL-HPA014957-25

• 
• 

Protein Description: BRI3 binding protein
Gene Name: BRI3BP
Alternative Gene Name: BNAS1, HCCR-2, KG19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037905: 87%, ENSRNOG00000000979: 85%
Entrez Gene ID: 140707
Uniprot ID: Q8WY22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVV
• Gene Sequence: MFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVV
• Gene ID - Mouse: ENSMUSG00000037905
• Gene ID - Rat: ENSRNOG00000000979
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.