Anti BRI3BP pAb (ATL-HPA014957)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014957-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: BRI3BP
Alternative Gene Name: BNAS1, HCCR-2, KG19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037905: 87%, ENSRNOG00000000979: 85%
Entrez Gene ID: 140707
Uniprot ID: Q8WY22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVV |
| Gene Sequence | MFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVV |
| Gene ID - Mouse | ENSMUSG00000037905 |
| Gene ID - Rat | ENSRNOG00000000979 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BRI3BP pAb (ATL-HPA014957) | |
| Datasheet | Anti BRI3BP pAb (ATL-HPA014957) Datasheet (External Link) |
| Vendor Page | Anti BRI3BP pAb (ATL-HPA014957) at Atlas Antibodies |
| Documents & Links for Anti BRI3BP pAb (ATL-HPA014957) | |
| Datasheet | Anti BRI3BP pAb (ATL-HPA014957) Datasheet (External Link) |
| Vendor Page | Anti BRI3BP pAb (ATL-HPA014957) |