Anti BRF2 pAb (ATL-HPA023378 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023378-25

Protein Description: BRF2, RNA polymerase III transcription initiation factor 50 kDa subunit
Gene Name: BRF2
Alternative Gene Name: BRFU, FLJ11052, TFIIIB50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031487: 84%, ENSRNOG00000012739: 87%
Entrez Gene ID: 55290
Uniprot ID: Q9HAW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRA
• Gene Sequence: VLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRA
• Gene ID - Mouse: ENSMUSG00000031487
• Gene ID - Rat: ENSRNOG00000012739
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.