Anti BRF2 pAb (ATL-HPA023378 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023378-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BRF2
Alternative Gene Name: BRFU, FLJ11052, TFIIIB50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031487: 84%, ENSRNOG00000012739: 87%
Entrez Gene ID: 55290
Uniprot ID: Q9HAW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRA |
Gene Sequence | VLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRA |
Gene ID - Mouse | ENSMUSG00000031487 |
Gene ID - Rat | ENSRNOG00000012739 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BRF2 pAb (ATL-HPA023378 w/enhanced validation) | |
Datasheet | Anti BRF2 pAb (ATL-HPA023378 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BRF2 pAb (ATL-HPA023378 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti BRF2 pAb (ATL-HPA023378 w/enhanced validation) | |
Datasheet | Anti BRF2 pAb (ATL-HPA023378 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BRF2 pAb (ATL-HPA023378 w/enhanced validation) |