Anti BRF2 pAb (ATL-HPA023378 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA023378-25
  • Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and BRF2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413154).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: BRF2, RNA polymerase III transcription initiation factor 50 kDa subunit
Gene Name: BRF2
Alternative Gene Name: BRFU, FLJ11052, TFIIIB50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031487: 84%, ENSRNOG00000012739: 87%
Entrez Gene ID: 55290
Uniprot ID: Q9HAW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRA
Gene Sequence VLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRA
Gene ID - Mouse ENSMUSG00000031487
Gene ID - Rat ENSRNOG00000012739
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BRF2 pAb (ATL-HPA023378 w/enhanced validation)
Datasheet Anti BRF2 pAb (ATL-HPA023378 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BRF2 pAb (ATL-HPA023378 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BRF2 pAb (ATL-HPA023378 w/enhanced validation)
Datasheet Anti BRF2 pAb (ATL-HPA023378 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BRF2 pAb (ATL-HPA023378 w/enhanced validation)