Anti BRF1 pAb (ATL-HPA074990)

Atlas Antibodies

Catalog No.:
ATL-HPA074990-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: BRF1, RNA polymerase III transcription initiation factor subunit
Gene Name: BRF1
Alternative Gene Name: BRF, GTF3B, hBRF, TAF3B2, TAF3C, TFIIIB90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011158: 96%, ENSRNOG00000014595: 96%
Entrez Gene ID: 2972
Uniprot ID: Q92994
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQ
Gene Sequence ASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQ
Gene ID - Mouse ENSMUSG00000011158
Gene ID - Rat ENSRNOG00000014595
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BRF1 pAb (ATL-HPA074990)
Datasheet Anti BRF1 pAb (ATL-HPA074990) Datasheet (External Link)
Vendor Page Anti BRF1 pAb (ATL-HPA074990) at Atlas Antibodies

Documents & Links for Anti BRF1 pAb (ATL-HPA074990)
Datasheet Anti BRF1 pAb (ATL-HPA074990) Datasheet (External Link)
Vendor Page Anti BRF1 pAb (ATL-HPA074990)