Anti BRF1 pAb (ATL-HPA051918)

Atlas Antibodies

SKU: ATL-HPA051918-100

• 
• 

Protein Description: BRF1, RNA polymerase III transcription initiation factor 90 kDa subunit
Gene Name: BRF1
Alternative Gene Name: BRF, GTF3B, hBRF, TAF3B2, TAF3C, TFIIIB90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011158: 88%, ENSRNOG00000014595: 87%
Entrez Gene ID: 2972
Uniprot ID: Q92994
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAKDGSTEDTASSLCGEEDTEDEELEAAASHLNKDL
• Gene Sequence: PSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAKDGSTEDTASSLCGEEDTEDEELEAAASHLNKDL
• Gene ID - Mouse: ENSMUSG00000011158
• Gene ID - Rat: ENSRNOG00000014595
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.