Anti BRF1 pAb (ATL-HPA051918)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051918-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: BRF1
Alternative Gene Name: BRF, GTF3B, hBRF, TAF3B2, TAF3C, TFIIIB90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011158: 88%, ENSRNOG00000014595: 87%
Entrez Gene ID: 2972
Uniprot ID: Q92994
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAKDGSTEDTASSLCGEEDTEDEELEAAASHLNKDL |
| Gene Sequence | PSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAKDGSTEDTASSLCGEEDTEDEELEAAASHLNKDL |
| Gene ID - Mouse | ENSMUSG00000011158 |
| Gene ID - Rat | ENSRNOG00000014595 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BRF1 pAb (ATL-HPA051918) | |
| Datasheet | Anti BRF1 pAb (ATL-HPA051918) Datasheet (External Link) |
| Vendor Page | Anti BRF1 pAb (ATL-HPA051918) at Atlas Antibodies |
| Documents & Links for Anti BRF1 pAb (ATL-HPA051918) | |
| Datasheet | Anti BRF1 pAb (ATL-HPA051918) Datasheet (External Link) |
| Vendor Page | Anti BRF1 pAb (ATL-HPA051918) |