Anti BRD9 pAb (ATL-HPA021465)

Atlas Antibodies

Catalog No.:
ATL-HPA021465-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: bromodomain containing 9
Gene Name: BRD9
Alternative Gene Name: FLJ13441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057649: 94%, ENSRNOG00000015676: 94%
Entrez Gene ID: 65980
Uniprot ID: Q9H8M2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLSSKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYS
Gene Sequence MGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLSSKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYS
Gene ID - Mouse ENSMUSG00000057649
Gene ID - Rat ENSRNOG00000015676
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BRD9 pAb (ATL-HPA021465)
Datasheet Anti BRD9 pAb (ATL-HPA021465) Datasheet (External Link)
Vendor Page Anti BRD9 pAb (ATL-HPA021465) at Atlas Antibodies

Documents & Links for Anti BRD9 pAb (ATL-HPA021465)
Datasheet Anti BRD9 pAb (ATL-HPA021465) Datasheet (External Link)
Vendor Page Anti BRD9 pAb (ATL-HPA021465)