Anti BRD9 pAb (ATL-HPA021465)
Atlas Antibodies
- SKU:
- ATL-HPA021465-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BRD9
Alternative Gene Name: FLJ13441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057649: 94%, ENSRNOG00000015676: 94%
Entrez Gene ID: 65980
Uniprot ID: Q9H8M2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLSSKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYS |
Gene Sequence | MGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLSSKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYS |
Gene ID - Mouse | ENSMUSG00000057649 |
Gene ID - Rat | ENSRNOG00000015676 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BRD9 pAb (ATL-HPA021465) | |
Datasheet | Anti BRD9 pAb (ATL-HPA021465) Datasheet (External Link) |
Vendor Page | Anti BRD9 pAb (ATL-HPA021465) at Atlas Antibodies |
Documents & Links for Anti BRD9 pAb (ATL-HPA021465) | |
Datasheet | Anti BRD9 pAb (ATL-HPA021465) Datasheet (External Link) |
Vendor Page | Anti BRD9 pAb (ATL-HPA021465) |