Anti BRD7 pAb (ATL-HPA060171)

Atlas Antibodies

Catalog No.:
ATL-HPA060171-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: bromodomain containing 7
Gene Name: BRD7
Alternative Gene Name: BP75, CELTIX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031660: 89%, ENSRNOG00000014419: 90%
Entrez Gene ID: 29117
Uniprot ID: Q9NPI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NAMIYNKPETIYYKAAKKLLHSGMKILSQERIQSLKQSIDFMADLQKTRKQKDGTDTSQSGEDGGCWQREREDSGDAEAHAFKSPSK
Gene Sequence NAMIYNKPETIYYKAAKKLLHSGMKILSQERIQSLKQSIDFMADLQKTRKQKDGTDTSQSGEDGGCWQREREDSGDAEAHAFKSPSK
Gene ID - Mouse ENSMUSG00000031660
Gene ID - Rat ENSRNOG00000014419
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BRD7 pAb (ATL-HPA060171)
Datasheet Anti BRD7 pAb (ATL-HPA060171) Datasheet (External Link)
Vendor Page Anti BRD7 pAb (ATL-HPA060171) at Atlas Antibodies

Documents & Links for Anti BRD7 pAb (ATL-HPA060171)
Datasheet Anti BRD7 pAb (ATL-HPA060171) Datasheet (External Link)
Vendor Page Anti BRD7 pAb (ATL-HPA060171)