Anti BRD4 pAb (ATL-HPA015055)

Atlas Antibodies

Catalog No.:
ATL-HPA015055-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: bromodomain containing 4
Gene Name: BRD4
Alternative Gene Name: CAP, HUNK1, HUNKI, MCAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024002: 76%, ENSRNOG00000006770: 94%
Entrez Gene ID: 23476
Uniprot ID: O60885
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP
Gene Sequence PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP
Gene ID - Mouse ENSMUSG00000024002
Gene ID - Rat ENSRNOG00000006770
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BRD4 pAb (ATL-HPA015055)
Datasheet Anti BRD4 pAb (ATL-HPA015055) Datasheet (External Link)
Vendor Page Anti BRD4 pAb (ATL-HPA015055) at Atlas Antibodies

Documents & Links for Anti BRD4 pAb (ATL-HPA015055)
Datasheet Anti BRD4 pAb (ATL-HPA015055) Datasheet (External Link)
Vendor Page Anti BRD4 pAb (ATL-HPA015055)
Citations for Anti BRD4 pAb (ATL-HPA015055) – 7 Found
Li, Gong-Quan; Guo, Wen-Zhi; Zhang, Yi; Seng, Jing-Jing; Zhang, Hua-Peng; Ma, Xiu-Xian; Zhang, Gong; Li, Jie; Yan, Bing; Tang, Hong-Wei; Li, Shan-Shan; Wang, Li-Dong; Zhang, Shui-Jun. Suppression of BRD4 inhibits human hepatocellular carcinoma by repressing MYC and enhancing BIM expression. Oncotarget. 2016;7(3):2462-74.  PubMed
Shah, Neel; Wang, Ping; Wongvipat, John; Karthaus, Wouter R; Abida, Wassim; Armenia, Joshua; Rockowitz, Shira; Drier, Yotam; Bernstein, Bradley E; Long, Henry W; Freedman, Matthew L; Arora, Vivek K; Zheng, Deyou; Sawyers, Charles L. Regulation of the glucocorticoid receptor via a BET-dependent enhancer drives antiandrogen resistance in prostate cancer. Elife. 2017;6( 28891793)  PubMed
Zuber, Johannes; Shi, Junwei; Wang, Eric; Rappaport, Amy R; Herrmann, Harald; Sison, Edward A; Magoon, Daniel; Qi, Jun; Blatt, Katharina; Wunderlich, Mark; Taylor, Meredith J; Johns, Christopher; Chicas, Agustin; Mulloy, James C; Kogan, Scott C; Brown, Patrick; Valent, Peter; Bradner, James E; Lowe, Scott W; Vakoc, Christopher R. RNAi screen identifies Brd4 as a therapeutic target in acute myeloid leukaemia. Nature. 2011;478(7370):524-8.  PubMed
Johnson, Gregory R; Li, Jieyue; Shariff, Aabid; Rohde, Gustavo K; Murphy, Robert F. Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules. Plos Computational Biology. 2015;11(12):e1004614.  PubMed
Lu, Rui; Wang, Jun; Ren, Zhihong; Yin, Jiekai; Wang, Yinsheng; Cai, Ling; Wang, Gang Greg. A Model System for Studying the DNMT3A Hotspot Mutation (DNMT3A(R882)) Demonstrates a Causal Relationship between Its Dominant-Negative Effect and Leukemogenesis. Cancer Research. 2019;79(14):3583-3594.  PubMed
Määttä, Tomi A; Rettel, Mandy; Sridharan, Sindhuja; Helm, Dominic; Kurzawa, Nils; Stein, Frank; Savitski, Mikhail M. Aggregation and disaggregation features of the human proteome. Molecular Systems Biology. 2020;16(10):e9500.  PubMed
Alonso-Curbelo, Direna; Ho, Yu-Jui; Burdziak, Cassandra; Maag, Jesper L V; Morris, John P 4th; Chandwani, Rohit; Chen, Hsuan-An; Tsanov, Kaloyan M; Barriga, Francisco M; Luan, Wei; Tasdemir, Nilgun; Livshits, Geulah; Azizi, Elham; Chun, Jaeyoung; Wilkinson, John E; Mazutis, Linas; Leach, Steven D; Koche, Richard; Pe'er, Dana; Lowe, Scott W. A gene-environment-induced epigenetic program initiates tumorigenesis. Nature. 2021;590(7847):642-648.  PubMed