Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042816-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BRD2
Alternative Gene Name: D6S113E, FSRG1, KIAA9001, NAT, RING3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024335: 99%, ENSRNOG00000000461: 99%
Entrez Gene ID: 6046
Uniprot ID: P25440
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGP |
Gene Sequence | SMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGP |
Gene ID - Mouse | ENSMUSG00000024335 |
Gene ID - Rat | ENSRNOG00000000461 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) | |
Datasheet | Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) | |
Datasheet | Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) |
Citations for Anti BRD2 pAb (ATL-HPA042816 w/enhanced validation) – 2 Found |
Lambert, Jean-Philippe; Picaud, Sarah; Fujisawa, Takao; Hou, Huayun; Savitsky, Pavel; Uusküla-Reimand, Liis; Gupta, Gagan D; Abdouni, Hala; Lin, Zhen-Yuan; Tucholska, Monika; Knight, James D R; Gonzalez-Badillo, Beatriz; St-Denis, Nicole; Newman, Joseph A; Stucki, Manuel; Pelletier, Laurence; Bandeira, Nuno; Wilson, Michael D; Filippakopoulos, Panagis; Gingras, Anne-Claude. Interactome Rewiring Following Pharmacological Targeting of BET Bromodomains. Molecular Cell. 2019;73(3):621-638.e17. PubMed |
Jostes, Sina; Nettersheim, Daniel; Fellermeyer, Martin; Schneider, Simon; Hafezi, François; Honecker, Friedemann; Schumacher, Valerie; Geyer, Matthias; Kristiansen, Glen; Schorle, Hubert. The bromodomain inhibitor JQ1 triggers growth arrest and apoptosis in testicular germ cell tumours in vitro and in vivo. Journal Of Cellular And Molecular Medicine. 2017;21(7):1300-1314. PubMed |