Anti BRAT1 pAb (ATL-HPA076508)

Atlas Antibodies

Catalog No.: ATL-HPA076508-25

Protein Description: BRCA1-associated ATM activator 1
Gene Name: BRAT1
Alternative Gene Name: BAAT1, C7orf27, MGC22916
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000148: 77%, ENSRNOG00000001236: 78%
Entrez Gene ID: 221927
Uniprot ID: Q6PJG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSCLGPTHMGPLALGILKLEHCPQALRTQAFQVLLQPLACVLKATVQAPGPPGLLDGTADDATTVDTLLASKSSCAGLLCRTLAHL
• Gene Sequence: LSCLGPTHMGPLALGILKLEHCPQALRTQAFQVLLQPLACVLKATVQAPGPPGLLDGTADDATTVDTLLASKSSCAGLLCRTLAHL
• Gene ID - Mouse: ENSMUSG00000000148
• Gene ID - Rat: ENSRNOG00000001236
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.