Anti BRAT1 pAb (ATL-HPA029455 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA029455-25
  • Immunohistochemical staining of human Testis shows moderate nuclear positivity in cells in seminiferous ducts.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and BRAT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407296).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: BRCA1-associated ATM activator 1
Gene Name: BRAT1
Alternative Gene Name: BAAT1, C7orf27, MGC22916
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000148: 79%, ENSRNOG00000001236: 79%
Entrez Gene ID: 221927
Uniprot ID: Q6PJG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLDWFKTVTEGESSVVLLQEHPCLVELLSHVLKVQDLSSGVLSFSLRLAGTFAAQENCFQYLQQGELLPGLFGEPG
Gene Sequence LLDWFKTVTEGESSVVLLQEHPCLVELLSHVLKVQDLSSGVLSFSLRLAGTFAAQENCFQYLQQGELLPGLFGEPG
Gene ID - Mouse ENSMUSG00000000148
Gene ID - Rat ENSRNOG00000001236
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BRAT1 pAb (ATL-HPA029455 w/enhanced validation)
Datasheet Anti BRAT1 pAb (ATL-HPA029455 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BRAT1 pAb (ATL-HPA029455 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BRAT1 pAb (ATL-HPA029455 w/enhanced validation)
Datasheet Anti BRAT1 pAb (ATL-HPA029455 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BRAT1 pAb (ATL-HPA029455 w/enhanced validation)