Anti BRAP pAb (ATL-HPA058820)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058820-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: BRAP
Alternative Gene Name: BRAP2, IMP, RNF52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029458: 98%, ENSRNOG00000046497: 97%
Entrez Gene ID: 8315
Uniprot ID: Q7Z569
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | STPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQC |
| Gene Sequence | STPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQC |
| Gene ID - Mouse | ENSMUSG00000029458 |
| Gene ID - Rat | ENSRNOG00000046497 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BRAP pAb (ATL-HPA058820) | |
| Datasheet | Anti BRAP pAb (ATL-HPA058820) Datasheet (External Link) |
| Vendor Page | Anti BRAP pAb (ATL-HPA058820) at Atlas Antibodies |
| Documents & Links for Anti BRAP pAb (ATL-HPA058820) | |
| Datasheet | Anti BRAP pAb (ATL-HPA058820) Datasheet (External Link) |
| Vendor Page | Anti BRAP pAb (ATL-HPA058820) |