Anti BRAP pAb (ATL-HPA040357)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040357-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BRAP
Alternative Gene Name: BRAP2, IMP, RNF52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029458: 84%, ENSRNOG00000046497: 83%
Entrez Gene ID: 8315
Uniprot ID: Q7Z569
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEA |
Gene Sequence | SLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEA |
Gene ID - Mouse | ENSMUSG00000029458 |
Gene ID - Rat | ENSRNOG00000046497 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BRAP pAb (ATL-HPA040357) | |
Datasheet | Anti BRAP pAb (ATL-HPA040357) Datasheet (External Link) |
Vendor Page | Anti BRAP pAb (ATL-HPA040357) at Atlas Antibodies |
Documents & Links for Anti BRAP pAb (ATL-HPA040357) | |
Datasheet | Anti BRAP pAb (ATL-HPA040357) Datasheet (External Link) |
Vendor Page | Anti BRAP pAb (ATL-HPA040357) |