Anti BRAP pAb (ATL-HPA040357)

Atlas Antibodies

Catalog No.:
ATL-HPA040357-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: BRCA1 associated protein
Gene Name: BRAP
Alternative Gene Name: BRAP2, IMP, RNF52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029458: 84%, ENSRNOG00000046497: 83%
Entrez Gene ID: 8315
Uniprot ID: Q7Z569
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEA
Gene Sequence SLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEA
Gene ID - Mouse ENSMUSG00000029458
Gene ID - Rat ENSRNOG00000046497
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BRAP pAb (ATL-HPA040357)
Datasheet Anti BRAP pAb (ATL-HPA040357) Datasheet (External Link)
Vendor Page Anti BRAP pAb (ATL-HPA040357) at Atlas Antibodies

Documents & Links for Anti BRAP pAb (ATL-HPA040357)
Datasheet Anti BRAP pAb (ATL-HPA040357) Datasheet (External Link)
Vendor Page Anti BRAP pAb (ATL-HPA040357)