Anti BRAP pAb (ATL-HPA040357)

Atlas Antibodies

SKU: ATL-HPA040357-25

• 
• 
• 

Protein Description: BRCA1 associated protein
Gene Name: BRAP
Alternative Gene Name: BRAP2, IMP, RNF52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029458: 84%, ENSRNOG00000046497: 83%
Entrez Gene ID: 8315
Uniprot ID: Q7Z569
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEA
• Gene Sequence: SLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEA
• Gene ID - Mouse: ENSMUSG00000029458
• Gene ID - Rat: ENSRNOG00000046497
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.