Anti BRAF pAb (ATL-HPA071048)

Atlas Antibodies

Catalog No.: ATL-HPA071048-25

Protein Description: B-Raf proto-oncogene, serine/threonine kinase
Gene Name: BRAF
Alternative Gene Name: BRAF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002413: 100%, ENSRNOG00000010957: 100%
Entrez Gene ID: 673
Uniprot ID: P15056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQL
• Gene Sequence: ADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQL
• Gene ID - Mouse: ENSMUSG00000002413
• Gene ID - Rat: ENSRNOG00000010957
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.