Anti BRAF pAb (ATL-HPA071048)

Atlas Antibodies

Catalog No.:
ATL-HPA071048-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: B-Raf proto-oncogene, serine/threonine kinase
Gene Name: BRAF
Alternative Gene Name: BRAF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002413: 100%, ENSRNOG00000010957: 100%
Entrez Gene ID: 673
Uniprot ID: P15056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQL
Gene Sequence ADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQL
Gene ID - Mouse ENSMUSG00000002413
Gene ID - Rat ENSRNOG00000010957
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BRAF pAb (ATL-HPA071048)
Datasheet Anti BRAF pAb (ATL-HPA071048) Datasheet (External Link)
Vendor Page Anti BRAF pAb (ATL-HPA071048) at Atlas Antibodies

Documents & Links for Anti BRAF pAb (ATL-HPA071048)
Datasheet Anti BRAF pAb (ATL-HPA071048) Datasheet (External Link)
Vendor Page Anti BRAF pAb (ATL-HPA071048)