Anti BRAF pAb (ATL-HPA001328)

Atlas Antibodies

Catalog No.: ATL-HPA001328-25

Protein Description: B-Raf proto-oncogene, serine/threonine kinase
Gene Name: BRAF
Alternative Gene Name: BRAF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002413: 93%, ENSRNOG00000010957: 92%
Entrez Gene ID: 673
Uniprot ID: P15056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS
• Gene Sequence: PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS
• Gene ID - Mouse: ENSMUSG00000002413
• Gene ID - Rat: ENSRNOG00000010957
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BRAF pAb (ATL-HPA001328) – 4 Found

Cao, Longxing; Wang, Zhongyong; Ma, Jiawei; Chen, Jinsheng; Zhu, Haojiang; Zhou, Xiaohua; Zhu, Qing; Dong, Jun; Lan, Qing; Huang, Qiang. Clinical characteristics and molecular pathology of skull ectopic thyroid cancer. Annals Of Translational Medicine. 2016;4(23):462. 

Beltran-Sastre, Violeta; Benisty, Hannah; Burnier, Julia; Berger, Imre; Serrano, Luis; Kiel, Christina. Tuneable endogenous mammalian target complementation via multiplexed plasmid-based recombineering. Scientific Reports. 2015;5( 26612112):17432. 

Kiel, Christina; Benisty, Hannah; Lloréns-Rico, Veronica; Serrano, Luis. The yin-yang of kinase activation and unfolding explains the peculiarity of Val600 in the activation segment of BRAF. Elife. 2016;5( 26744778):e12814. 

Zheng, Limei; Yan, Xiaorong; Hu, Chengcong; Zhang, Peng; Chen, Yupeng; Zheng, Qiaoyan; Hu, Liwen; Wang, Mi; Li, Guoping; Wu, Ping; Jiang, Changzhen; Tian, Jing; Zhang, Sheng; Wang, Xingfu. Observation of Clinicopathologic Features of Pituitary Adenoma With Neuronal Differentiation. Frontiers In Endocrinology. 13( 35370935):848762.