Anti BPTF pAb (ATL-HPA048289)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048289-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BPTF
Alternative Gene Name: FAC1, FALZ, NURF301
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040481: 94%, ENSRNOG00000047296: 90%
Entrez Gene ID: 2186
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TTIASTGQTFQITGNPVTMAGKVITKLPLPANSKIVAVNVPATQGGIVQVHQ |
Gene Sequence | TTIASTGQTFQITGNPVTMAGKVITKLPLPANSKIVAVNVPATQGGIVQVHQ |
Gene ID - Mouse | ENSMUSG00000040481 |
Gene ID - Rat | ENSRNOG00000047296 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BPTF pAb (ATL-HPA048289) | |
Datasheet | Anti BPTF pAb (ATL-HPA048289) Datasheet (External Link) |
Vendor Page | Anti BPTF pAb (ATL-HPA048289) at Atlas Antibodies |
Documents & Links for Anti BPTF pAb (ATL-HPA048289) | |
Datasheet | Anti BPTF pAb (ATL-HPA048289) Datasheet (External Link) |
Vendor Page | Anti BPTF pAb (ATL-HPA048289) |