Anti BPNT1 pAb (ATL-HPA048461)

Atlas Antibodies

Catalog No.: ATL-HPA048461-100

Protein Description: 3'(2'), 5'-bisphosphate nucleotidase 1
Gene Name: BPNT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026617: 94%, ENSRNOG00000002378: 92%
Entrez Gene ID: 10380
Uniprot ID: O95861
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGP
• Gene Sequence: SEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGP
• Gene ID - Mouse: ENSMUSG00000026617
• Gene ID - Rat: ENSRNOG00000002378
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.