Anti BPNT1 pAb (ATL-HPA048461)

Atlas Antibodies

Catalog No.:
ATL-HPA048461-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: 3'(2'), 5'-bisphosphate nucleotidase 1
Gene Name: BPNT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026617: 94%, ENSRNOG00000002378: 92%
Entrez Gene ID: 10380
Uniprot ID: O95861
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGP
Gene Sequence SEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGP
Gene ID - Mouse ENSMUSG00000026617
Gene ID - Rat ENSRNOG00000002378
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BPNT1 pAb (ATL-HPA048461)
Datasheet Anti BPNT1 pAb (ATL-HPA048461) Datasheet (External Link)
Vendor Page Anti BPNT1 pAb (ATL-HPA048461) at Atlas Antibodies

Documents & Links for Anti BPNT1 pAb (ATL-HPA048461)
Datasheet Anti BPNT1 pAb (ATL-HPA048461) Datasheet (External Link)
Vendor Page Anti BPNT1 pAb (ATL-HPA048461)