Anti BPIFC pAb (ATL-HPA037665)

Atlas Antibodies

Catalog No.:
ATL-HPA037665-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: BPI fold containing family C
Gene Name: BPIFC
Alternative Gene Name: BPIL2, dJ149A16.7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050108: 70%, ENSRNOG00000022937: 75%
Entrez Gene ID: 254240
Uniprot ID: Q8NFQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NVLSRIAEIYILSQPFMVRIMATEPPIINLQPGNFTLDIPASIMMLTQPKNSTVETIVSMDFVASTSVGLVILGQRLVCSLSLNRFR
Gene Sequence NVLSRIAEIYILSQPFMVRIMATEPPIINLQPGNFTLDIPASIMMLTQPKNSTVETIVSMDFVASTSVGLVILGQRLVCSLSLNRFR
Gene ID - Mouse ENSMUSG00000050108
Gene ID - Rat ENSRNOG00000022937
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BPIFC pAb (ATL-HPA037665)
Datasheet Anti BPIFC pAb (ATL-HPA037665) Datasheet (External Link)
Vendor Page Anti BPIFC pAb (ATL-HPA037665) at Atlas Antibodies

Documents & Links for Anti BPIFC pAb (ATL-HPA037665)
Datasheet Anti BPIFC pAb (ATL-HPA037665) Datasheet (External Link)
Vendor Page Anti BPIFC pAb (ATL-HPA037665)