Anti BPIFC pAb (ATL-HPA037665)

Atlas Antibodies

Catalog No.: ATL-HPA037665-25

Protein Description: BPI fold containing family C
Gene Name: BPIFC
Alternative Gene Name: BPIL2, dJ149A16.7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050108: 70%, ENSRNOG00000022937: 75%
Entrez Gene ID: 254240
Uniprot ID: Q8NFQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVLSRIAEIYILSQPFMVRIMATEPPIINLQPGNFTLDIPASIMMLTQPKNSTVETIVSMDFVASTSVGLVILGQRLVCSLSLNRFR
• Gene Sequence: NVLSRIAEIYILSQPFMVRIMATEPPIINLQPGNFTLDIPASIMMLTQPKNSTVETIVSMDFVASTSVGLVILGQRLVCSLSLNRFR
• Gene ID - Mouse: ENSMUSG00000050108
• Gene ID - Rat: ENSRNOG00000022937
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.