Anti BPIFB3 pAb (ATL-HPA045741)

Atlas Antibodies

Catalog No.:
ATL-HPA045741-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: BPI fold containing family B, member 3
Gene Name: BPIFB3
Alternative Gene Name: C20orf185, dJ726C3.4, LPLUNC3, RYA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068008: 84%, ENSRNOG00000013398: 84%
Entrez Gene ID: 359710
Uniprot ID: P59826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSLGALGSVEFSLATLPLISNQYIELDINPIVKSVAGDIIDFPKSRAPAKVPPKKDHTSQVMVPLYLFNTTFGL
Gene Sequence VSLGALGSVEFSLATLPLISNQYIELDINPIVKSVAGDIIDFPKSRAPAKVPPKKDHTSQVMVPLYLFNTTFGL
Gene ID - Mouse ENSMUSG00000068008
Gene ID - Rat ENSRNOG00000013398
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BPIFB3 pAb (ATL-HPA045741)
Datasheet Anti BPIFB3 pAb (ATL-HPA045741) Datasheet (External Link)
Vendor Page Anti BPIFB3 pAb (ATL-HPA045741) at Atlas Antibodies

Documents & Links for Anti BPIFB3 pAb (ATL-HPA045741)
Datasheet Anti BPIFB3 pAb (ATL-HPA045741) Datasheet (External Link)
Vendor Page Anti BPIFB3 pAb (ATL-HPA045741)