Anti BPHL pAb (ATL-HPA036753 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA036753-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: biphenyl hydrolase-like (serine hydrolase)
Gene Name: BPHL
Alternative Gene Name: Bph-rp, MCNAA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038286: 84%, ENSRNOG00000017577: 87%
Entrez Gene ID: 670
Uniprot ID: Q86WA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEG
Gene Sequence RTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEG
Gene ID - Mouse ENSMUSG00000038286
Gene ID - Rat ENSRNOG00000017577
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BPHL pAb (ATL-HPA036753 w/enhanced validation)
Datasheet Anti BPHL pAb (ATL-HPA036753 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BPHL pAb (ATL-HPA036753 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BPHL pAb (ATL-HPA036753 w/enhanced validation)
Datasheet Anti BPHL pAb (ATL-HPA036753 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BPHL pAb (ATL-HPA036753 w/enhanced validation)