Anti BPHL pAb (ATL-HPA036752 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA036752-25

• 
• 
• 

Protein Description: biphenyl hydrolase-like (serine hydrolase)
Gene Name: BPHL
Alternative Gene Name: Bph-rp, MCNAA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038286: 82%, ENSRNOG00000017577: 80%
Entrez Gene ID: 670
Uniprot ID: Q86WA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADF
• Gene Sequence: SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADF
• Gene ID - Mouse: ENSMUSG00000038286
• Gene ID - Rat: ENSRNOG00000017577
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.