Anti BPGM pAb (ATL-HPA016493 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016493-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: BPGM
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038871: 93%, ENSRNOG00000010133: 90%
Entrez Gene ID: 669
Uniprot ID: P07738
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQA |
| Gene Sequence | RRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQA |
| Gene ID - Mouse | ENSMUSG00000038871 |
| Gene ID - Rat | ENSRNOG00000010133 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BPGM pAb (ATL-HPA016493 w/enhanced validation) | |
| Datasheet | Anti BPGM pAb (ATL-HPA016493 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BPGM pAb (ATL-HPA016493 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BPGM pAb (ATL-HPA016493 w/enhanced validation) | |
| Datasheet | Anti BPGM pAb (ATL-HPA016493 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BPGM pAb (ATL-HPA016493 w/enhanced validation) |
| Citations for Anti BPGM pAb (ATL-HPA016493 w/enhanced validation) – 2 Found |
| Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038. PubMed |
| Cai, Fei-Fei; Song, Ya-Nan; Lu, Yi-Yu; Zhang, Yongyu; Hu, Yi-Yang; Su, Shi-Bing. Analysis of plasma metabolic profile, characteristics and enzymes in the progression from chronic hepatitis B to hepatocellular carcinoma. Aging. 2020;12(14):14949-14965. PubMed |