Anti BORCS8 pAb (ATL-HPA045700)

Atlas Antibodies

Catalog No.: ATL-HPA045700-25

Protein Description: BLOC-1 related complex subunit 8
Gene Name: BORCS8
Alternative Gene Name: MEF2BNB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002345: 100%, ENSRNOG00000020427: 100%
Entrez Gene ID: 729991
Uniprot ID: Q96FH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQS
• Gene Sequence: MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQS
• Gene ID - Mouse: ENSMUSG00000002345
• Gene ID - Rat: ENSRNOG00000020427
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.