Anti BORCS6 pAb (ATL-HPA060791)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060791-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BORCS6
Alternative Gene Name: C17orf59, FLJ20014
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045176: 50%, ENSRNOG00000006513: 54%
Entrez Gene ID: 54785
Uniprot ID: Q96GS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PETDLLAVAEHQALVFGGGPGRTSSEPPAGLRVSGEEETENVGGANRHPRTSPKTSSCGVVHRPEREALENEPGPQGTLS |
Gene Sequence | PETDLLAVAEHQALVFGGGPGRTSSEPPAGLRVSGEEETENVGGANRHPRTSPKTSSCGVVHRPEREALENEPGPQGTLS |
Gene ID - Mouse | ENSMUSG00000045176 |
Gene ID - Rat | ENSRNOG00000006513 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BORCS6 pAb (ATL-HPA060791) | |
Datasheet | Anti BORCS6 pAb (ATL-HPA060791) Datasheet (External Link) |
Vendor Page | Anti BORCS6 pAb (ATL-HPA060791) at Atlas Antibodies |
Documents & Links for Anti BORCS6 pAb (ATL-HPA060791) | |
Datasheet | Anti BORCS6 pAb (ATL-HPA060791) Datasheet (External Link) |
Vendor Page | Anti BORCS6 pAb (ATL-HPA060791) |