Anti BORCS6 pAb (ATL-HPA060791)

Atlas Antibodies

Catalog No.:
ATL-HPA060791-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: BLOC-1 related complex subunit 6
Gene Name: BORCS6
Alternative Gene Name: C17orf59, FLJ20014
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045176: 50%, ENSRNOG00000006513: 54%
Entrez Gene ID: 54785
Uniprot ID: Q96GS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PETDLLAVAEHQALVFGGGPGRTSSEPPAGLRVSGEEETENVGGANRHPRTSPKTSSCGVVHRPEREALENEPGPQGTLS
Gene Sequence PETDLLAVAEHQALVFGGGPGRTSSEPPAGLRVSGEEETENVGGANRHPRTSPKTSSCGVVHRPEREALENEPGPQGTLS
Gene ID - Mouse ENSMUSG00000045176
Gene ID - Rat ENSRNOG00000006513
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BORCS6 pAb (ATL-HPA060791)
Datasheet Anti BORCS6 pAb (ATL-HPA060791) Datasheet (External Link)
Vendor Page Anti BORCS6 pAb (ATL-HPA060791) at Atlas Antibodies

Documents & Links for Anti BORCS6 pAb (ATL-HPA060791)
Datasheet Anti BORCS6 pAb (ATL-HPA060791) Datasheet (External Link)
Vendor Page Anti BORCS6 pAb (ATL-HPA060791)