Anti BORCS6 pAb (ATL-HPA060791)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060791-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: BORCS6
Alternative Gene Name: C17orf59, FLJ20014
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045176: 50%, ENSRNOG00000006513: 54%
Entrez Gene ID: 54785
Uniprot ID: Q96GS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PETDLLAVAEHQALVFGGGPGRTSSEPPAGLRVSGEEETENVGGANRHPRTSPKTSSCGVVHRPEREALENEPGPQGTLS |
| Gene Sequence | PETDLLAVAEHQALVFGGGPGRTSSEPPAGLRVSGEEETENVGGANRHPRTSPKTSSCGVVHRPEREALENEPGPQGTLS |
| Gene ID - Mouse | ENSMUSG00000045176 |
| Gene ID - Rat | ENSRNOG00000006513 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BORCS6 pAb (ATL-HPA060791) | |
| Datasheet | Anti BORCS6 pAb (ATL-HPA060791) Datasheet (External Link) |
| Vendor Page | Anti BORCS6 pAb (ATL-HPA060791) at Atlas Antibodies |
| Documents & Links for Anti BORCS6 pAb (ATL-HPA060791) | |
| Datasheet | Anti BORCS6 pAb (ATL-HPA060791) Datasheet (External Link) |
| Vendor Page | Anti BORCS6 pAb (ATL-HPA060791) |