Anti BORCS5 pAb (ATL-HPA043627)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043627-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BORCS5
Alternative Gene Name: LOH12CR1, LOH1CR12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042992: 100%, ENSRNOG00000006505: 99%
Entrez Gene ID: 118426
Uniprot ID: Q969J3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDL |
| Gene Sequence | VIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDL |
| Gene ID - Mouse | ENSMUSG00000042992 |
| Gene ID - Rat | ENSRNOG00000006505 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BORCS5 pAb (ATL-HPA043627) | |
| Datasheet | Anti BORCS5 pAb (ATL-HPA043627) Datasheet (External Link) |
| Vendor Page | Anti BORCS5 pAb (ATL-HPA043627) at Atlas Antibodies |
| Documents & Links for Anti BORCS5 pAb (ATL-HPA043627) | |
| Datasheet | Anti BORCS5 pAb (ATL-HPA043627) Datasheet (External Link) |
| Vendor Page | Anti BORCS5 pAb (ATL-HPA043627) |