Anti BORCS5 pAb (ATL-HPA043627)

Atlas Antibodies

Catalog No.: ATL-HPA043627-25

Protein Description: BLOC-1 related complex subunit 5
Gene Name: BORCS5
Alternative Gene Name: LOH12CR1, LOH1CR12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042992: 100%, ENSRNOG00000006505: 99%
Entrez Gene ID: 118426
Uniprot ID: Q969J3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDL
• Gene Sequence: VIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDL
• Gene ID - Mouse: ENSMUSG00000042992
• Gene ID - Rat: ENSRNOG00000006505
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.